PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0075000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 557aa    MW: 59848.5 Da    PI: 8.0969
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0075000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-093493861954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+  +++ LAk++gL+ +qV++WF N R +
  Spipo6G0075000 349 FEHflHPYPTDMDKQLLAKQTGLSRNQVSNWFINARVR 386
                     554458******************************98 PP

2BELL95.35.5e-31217284572
            BELL   5 lqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      ++ k++L+ +l+eV++rYkqy++q+q+vissFeav gl  a+pY++lAl+ +S+hF++Lk+aiaeq+
  Spipo6G0075000 217 QRRLKSRLILMLDEVYRRYKQYYHQIQAVISSFEAVSGLSMAAPYAALALRSLSKHFKSLKNAIAEQL 284
                     56679*************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-36152282IPR006563POX domain
PfamPF075269.0E-30157281IPR006563POX domain
PROSITE profilePS5007112.39327390IPR001356Homeobox domain
CDDcd000867.98E-14330391No hitNo description
SMARTSM003891.5E-10330394IPR001356Homeobox domain
SuperFamilySSF466895.13E-17331397IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-27333394IPR009057Homeodomain-like
PfamPF059203.1E-18347386IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MLGSCPRGGG EQPPGVVAAG GQLADGRGGC SFYHVPQQCR REKLRYANAT ESAPQLFMRP  60
SPSSHMLNPH YNTSPYDHGF PPPDLFNTNP LLGGDGSGQH LGQGFSLSLS SPVVDDKQHH  120
HGQAQGASPM AGPPPLVPVV QRVAPVPAGP FTGYATILNS SRFLRPALQL LEETCGGGGP  180
VGGSLAGSGV EIETLDISSD IPEATDTLDG VIGGGEQRRL KSRLILMLDE VYRRYKQYYH  240
QIQAVISSFE AVSGLSMAAP YAALALRSLS KHFKSLKNAI AEQLRFASKC IGKEGQSGDQ  300
IPSYRLASNA GLCFPRVPHC SGAVSQQPAW RPQRGLPERA VAVLRSWLFE HFLHPYPTDM  360
DKQLLAKQTG LSRNQVSNWF INARVRLWKP MVEEIHSLEQ QHDHRKAPQS ESSRGASKQP  420
ELLTSPPAVS AVEKQAPHAV SSPYKRSRAE FSQLPNHIKD PLNFSLEDFS AAQHRAGVPV  480
SIAGGVHGGV SLTLGLHQNG GTICFSDPAM PMSGVHRFGI EDGGGVGFAM GGGAFEGQEQ  540
HHHFAKEFDG QLHHIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A6e-16336394563Homeobox protein Meis2
4xrm_B6e-16336394563Homeobox protein Meis2
4xrs_A5e-16336393158Homeobox protein Meis1
4xrs_B5e-16336393158Homeobox protein Meis1
5bng_A5e-16336394159Homeobox protein Meis2
5bng_B5e-16336394159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLF6HL251e-117F6HL25_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t011e-117(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.16e-76TALE family protein